Overview

  • Product name

    Recombinant Human MSH4 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      YKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTP EMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQV PEKTEE
    • Amino acids

      831 to 936
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hMSH4
    • MSH 4
    • MSH4
    • MSH4_HUMAN
    • MutS homolog 4
    • MutS homolog 4 (E. Coli)
    • MutS protein homolog 4
    see all
  • Function

    Involved in meiotic recombination. Required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.
  • Tissue specificity

    Testis and ovary specific.
  • Sequence similarities

    Belongs to the DNA mismatch repair MutS family.
  • Information by UniProt

Images

  • ab158919 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up