Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIP EYLIHFNGWNRSWDRWAAEDHVLRDTDEN
    • Amino acids

      1 to 79
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MSL3
    • AU018931
    • DKFZp586J1822
    • Drosophila MSL3 like 1
    • Male specific lethal 3 (Drosophila) like 1
    • Male specific lethal 3 homolog
    • Male specific lethal 3 homolog (Drosophila)
    • Male specific lethal 3 homolog 1
    • Male specific lethal 3 homolog 1 (Drosophila)
    • Male specific lethal 3 like 1
    • Male specific lethal 3 like 1 (Drosophila)
    • Male specific lethal 3 protein like 1
    • Male-specific lethal 3 homolog
    • Male-specific lethal-3 homolog 1
    • Male-specific lethal-3 protein-like 1
    • MS3L1_HUMAN
    • MSL3
    • MSL3 like 1
    • MSL3-like 1
    • Msl31
    • MSL3L1
    • OTTHUMP00000022911
    • OTTHUMP00000022912
    see all
  • Information by UniProt

Images

  • ab153141 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up