Overview

  • Product name

    Recombinant Human MSP/MST1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDV ADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDL FQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRN GLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYR GAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPW CYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGM RAAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPH KPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCAD DQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRN RQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEP SLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGL LAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVF VDWIHKVMRLG
    • Amino acids

      1 to 711
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D3F15S2
    • DNF15S2
    • Hepatocyte growth factor like protein
    • Hepatocyte growth factor like protein alpha chain
    • Hepatocyte growth factor like protein beta chain
    • Hepatocyte growth factor like protein homolog
    • Hepatocyte growth factor-like protein beta chain
    • HGFL
    • HGFL_HUMAN
    • Macrophage stimulating 1 (hepatocyte growth factor like)
    • Macrophage stimulatory protein
    • Macrophage-stimulating protein
    • MSP
    • MST1
    • NF15S2
    • OTTHUMP00000208927
    see all
  • Function

    Probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
  • Sequence similarities

    Belongs to the peptidase S1 family. Plasminogen subfamily.
    Contains 4 kringle domains.
    Contains 1 PAN domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    May be cleaved after Arg-483, to yield two chains held together by disulfide bonds, or two separate polypeptides.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab158921 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up