Description

  • Product name

    Recombinant Human MST protein
  • Purity

    > 95 % SDS-PAGE.
    ab139234 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMASPQLCRALVSAQWVAEALRAPRAG QPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHML PGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVS LLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESR RFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSP EEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSW VEWYMRARPEDVISEGRGKTH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      1 to 297
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Protein previously labeled as MPST.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 3 mercaptopyruvate sulfurtransferase
    • 3-mercaptopyruvate sulfurtransferase
    • Human liver rhodanese
    • Mercaptopyruvate sulfurtransferase
    • MGC24539
    • MPST
    • MST
    • THTM_HUMAN
    • TST2
    see all
  • Function

    Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.
  • Sequence similarities

    Contains 2 rhodanese domains.
  • Domain

    The structure consists of 2 domains of very similar conformation, suggesting a common evolutionary origin. However, the sequences of the 2 domains are very different.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139234.

References

ab139234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up