Description

  • Product name

    Recombinant Human MTAP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKI KNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLRE EIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATC RTMS
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 154

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5' methylthioadenosine phosphorylase
    • 5''-methylthioadenosine phosphorylase
    • BDMF
    • c86fus
    • DMSFH
    • DMSMFH
    • Epididymis luminal protein 249
    • HEL 249
    • LGMBF
    • MeSAdo phosphorylase
    • Methylthioadenosine phosphorylase
    • MSAP
    • MTA phosphorylase
    • MTAP
    • MTAP_HUMAN
    • MTAPase
    • S methyl 5 thioadenosine phosphorylase
    • S methyl 5' thioadenosine phosphorylase
    • S-methyl-5''-thioadenosine phosphorylase
    see all
  • Function

    Plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the PNP/MTAP phosphorylase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132581 stained with Coomassie Blue.

References

ab132581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up