Overview

  • Product name

    Recombinant Human MTERFD1/MTERF3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSD NCFLQWGFKTYRTSSLWNSSQSTSSSSQENNSAQSSLLPSMNEQSQKTQN ISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFTLRDYV DHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGI EDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFL LNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV YRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVK FPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCE EIAKASVQDFEKFLKTL
    • Amino acids

      1 to 417
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as MTERFD1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CGI 12
    • mitochondrial
    • Mitochondrial transcription termination factor 3
    • MTER1_HUMAN
    • MTERF domain containing 1
    • mTERF domain containing protein 1 mitochondrial
    • mTERF domain-containing protein 1
    • mTERF3
    • Mterfd1
    • Transcription termination factor 3, mitochondrial
    see all
  • Function

    Binds promoter DNA and regulates initiation of transcription. Required for normal mitochondrial transcription, and for normal assembly of mitochondrial respiratory complexes. Required for normal mitochondrial function.
  • Tissue specificity

    Highly expressed in heart, liver, kidney and testis. Detected at lower levels in brain, spleen and lung.
  • Sequence similarities

    Belongs to the mTERF family.
  • Domain

    Contains seven structural repeats of about 35 residues, where each repeat contains three helices. The repeats form a superhelical structure with a solenoid shape.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab162384 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up