Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKR VCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPN KMLE
    • Amino acids

      201 to 304
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AML1 MTG8
    • cbfa2t2
    • Core binding factor runt domain alpha subunit 2 translocated to 2
    • core-binding factor, runt domain, alpha subunit 2
    • DKFZp313F2116
    • EHT
    • ETO homolog on chromosome 20
    • ETO homologous on chromosome 20
    • MTG 8 like protein
    • MTG 8 related protein 1
    • MTG8 like protein
    • MTG8 related protein 1
    • MTG8-like protein
    • MTG8-related protein 1
    • MTG8R_HUMAN
    • MTGR 1
    • Myeloid translocation gene related protein 1
    • Myeloid translocation related protein 1
    • Myeloid translocation-related protein 1
    • p85
    • Protein CBFA2T2
    • ZMYND 3
    • ZMYND3
    see all
  • Function

    May function as a complex with the chimeric protein RUNX1/AML1-CBFA2T1/MTG8 which is produced in acute myeloid leukemia with the chromosomal translocation t(8;21). May thus be involved in the repression of AML1-dependent transcription and the induction of G-CSF/CSF3-dependent cell growth. May be a tumor suppressor gene candidate involved in myeloid tumors with the deletion of the 20q11 region.
  • Tissue specificity

    Ubiquitously expressed in fetal and adult tissues. Highly expressed in adult brain, heart, lung, kidney, lymph node, appendix, thymus, testis, uterus, small intestine, prostate and thymus.
  • Sequence similarities

    Belongs to the CBFA2T family.
    Contains 1 MYND-type zinc finger.
    Contains 1 TAFH (NHR1) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab152955 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up