Recombinant Human MTHFD1L protein (ab161832)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVLALTDSLADMKARLGRMVVASDKSGQPVTADDLGVTGALTVLMKDAI KPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEA GFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPL KKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDL VCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQ VPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHL SLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCF YDIDLDTETEQVKGLF
    • Amino acids
      1 to 366
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 10-formyl-THF synthetase
    • C1TM_HUMAN
    • Formyltetrahydrofolate synthetase
    • formyltetrahydrofolate synthetase domain containing 1
    • FTHFSDC1
    • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
    • mitochondrial
    • Monofunctional C1-tetrahydrofolate synthase
    • MTC1THFS
    • MTHFD1L
    • RP1-292B18.2
    see all
  • Function
    May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2.
  • Tissue specificity
    Detected in most tissues, highest expression found in placenta, thymus and brain. Low expression is found in liver and skeletal muscle. Up-regulated in colon adenocarcinoma.
  • Pathway
    One-carbon metabolism; tetrahydrofolate interconversion.
  • Sequence similarities
    In the N-terminal section; belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.
    In the C-terminal section; belongs to the formate--tetrahydrofolate ligase family.
  • Domain
    This monofunctional enzyme consists of two major domains: an N-terminal inactive methylene-THF dehydrogenase and cyclohydrolase domain and an active larger formyl-THF synthetase C-terminal domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab161832 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up