Description

  • Product name

    Recombinant Human MTHFD2 protein
    See all MTHFD2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab202178 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSLAAVRNEAVVISGRKLAQQIKQEVRQE VEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPA SISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDG FHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVG MPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGI PNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQKAGYIT PVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      30 to 350
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006627.

Specifications

Our Abpromise guarantee covers the use of ab202178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 79% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
    • Descriptions
    • Methenyltetrahydrofolate cyclohydrolase
    • methylene tetrahydrofolate dehydrogenase (NAD+ dependent)
    • methylenetetrahydrofolate dehydrogenase (NADP+ dependent)
    • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2
    • methylenetetrahydrofolate dehydrogenase 2
    • MGC82516
    • MTDC_HUMAN
    • MTHFD2
    • mthfd2 methylene tetrahydrofolate dehydrogenase (NAD+ dependent)
    • NAD-dependent methylene tetrahydrofolate dehydrogenase
    • NAD-dependent methylenetetrahydrofolate dehydrogenase
    • NMDMC
    see all
  • Sequence similarities

    Belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.
  • Developmental stage

    Expressed only in developing normal tissues.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202178 (3 µg).

References

ab202178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up