Overview

  • Product name
    Recombinant Human MTMR14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAW ADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKV KFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFN WKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSD DDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKPTEILYLTVAYD WFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARDG GFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAG APTQAAWLAALSDRETRLQEVRSAFLAAYSSTVGLRAVAPSPSGAIGGLL EQFARGVGLRSISSNAL
    • Amino acids
      1 to 417
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C3orf29
    • Egg derived tyrosine phosphatase homolog
    • FLJ11546
    • FLJ22405
    • FLJ46453
    • FLJ90311
    • HCV NS5A transactivated protein 4 splice variant A binding protein 1
    • HCV NS5A-transactivated protein 4 splice variant A-binding protein 1
    • hEDTP
    • hJumpy
    • jumpy
    • MTMR 14
    • MTMR14
    • MTMRE_HUMAN
    • Myotubularin related protein 14
    • Myotubularin-related protein 14
    • NS5ATP4ABP1
    see all
  • Function
    Lipid phosphatase which efficiently dephosphorylates phosphatidylinositol 3-phosphate (PtdIns3P) and PtdIns(3,5)P2; inactive toward PtdIns4P, PtdIns(3,4)P2, PtdIns(4,5)P2 and PtdIns(3,4,5)P3.
  • Tissue specificity
    Expressed in various tissues, including heart, skeletal muscle, placenta, liver, lung, kidney and pancreas.
  • Involvement in disease
    Defects in MTMR14 may be a cause of centronuclear myopathy autosomal dominant (ADCNM) [MIM:160150]; also known as autosomal dominant myotubular myopathy. Centronuclear myopathies are congenital muscle disorders characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily.
  • Cellular localization
    Cytoplasm. Found in reticular structures and plasma membrane ruffles. Concentrated near the nucleus.
  • Information by UniProt

Images

  • ab163837 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up