Description

  • Product name

    Recombinant Human MTPAP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAVPGVGLLTRLNLCARRRTRVQRPIVRLLSCPGTVAKDLRRDEQPSGSV ETGFEDKIPKRRFSEMQNERREQAQRTVLIHCPEKISENKFLKYLSQFGP INNHFFYESFGLYAVVEFCQKESIGSLQNGTHTPSTAMETAIPFRSRFFN LKLKNQTSERSRVRSSNQLPRSNKQLFELLCYAESIDDQLNTLLKEFQLT EENTKLRYLTCSLIEDMAAAHFPDCIVRPFGSSVNTFGKLGCDLDMFLDL DETRNLSAHKISGNFLMEFQVKNVPSERIATQKILSVLGECLDHFGPGCV GVQKILNARCPLVRFSHQASGFQCDLTTNNRIALTSSELLYIYGALDSRV RALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLD SLKTLADAEDKCVIEGNNRTFVRDLSRIKPSQNTETLELLLKEFFEYFGN FAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVD LARESAWILQQEDTDRPSISSNRPWGLVSLLLPSAPNRKSFTKKKNNKFA IETVKNLLESLKGNRTENFTKTSGKRTISTQT
    • Amino acids

      1 to 582
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Poly(A) RNA polymerase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 0610027A18Rik
    • AW551379
    • EC 2.7.7.19
    • FLJ10486
    • mitochondrial
    • Mitochondrial poly(A) polymerase
    • mtPAP
    • PAP
    • PAP-associated domain-containing protein 1
    • PAPD1
    • PAPD1_HUMAN
    • Poly(A) RNA polymerase
    • Poly(A) RNA polymerase, mitochondrial
    • Poly(A) RNA polymerase, mitochondrial precursor
    • Polynucleotide adenylyltransferase
    • RP11-305E6.3
    • Terminal uridylyltransferase 1
    • TUTase 1
    see all
  • Function

    Polymerase that creates the 3' poly(A) tail of mitochondrial transcripts. Can use all four nucleotides, but has higher activity with ATP and UTP (in vitro). Plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylation of mature histone mRNAs before their degradation is initiated. Might be responsible for the creation of some UAA stop codons which are not encoded in mtDNA.
  • Tissue specificity

    Ubiquitous, with stronger expression in tissues with high energy requirements: heart, brain, and skeletal muscle.
  • Involvement in disease

    Defects in MTPAP are the cause of spastic ataxia autosomal recessive type 4 (SPAX4) [MIM:613672]. A slowly progressive neurodegenerative disease characterized by cerebellar ataxia, spastic paraparesis, dysarthria, and optic atrophy. Note=Affected individuals exhibit a drastic decrease in poly(A) tail length of representative mitochondrial mRNA transcripts, including COX1 and RNA14 (PubMed:20970105).
  • Sequence similarities

    Belongs to the DNA polymerase type-B-like family.
    Contains 1 PAP-associated domain.
  • Cellular localization

    Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • ab162984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up