Overview

  • Product name
    Recombinant Human MTPAP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVPGVGLLTRLNLCARRRTRVQRPIVRLLSCPGTVAKDLRRDEQPSGSV ETGFEDKIPKRRFSEMQNERREQAQRTVLIHCPEKISENKFLKYLSQFGP INNHFFYESFGLYAVVEFCQKESIGSLQNGTHTPSTAMETAIPFRSRFFN LKLKNQTSERSRVRSSNQLPRSNKQLFELLCYAESIDDQLNTLLKEFQLT EENTKLRYLTCSLIEDMAAAHFPDCIVRPFGSSVNTFGKLGCDLDMFLDL DETRNLSAHKISGNFLMEFQVKNVPSERIATQKILSVLGECLDHFGPGCV GVQKILNARCPLVRFSHQASGFQCDLTTNNRIALTSSELLYIYGALDSRV RALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRSPPILPTLD SLKTLADAEDKCVIEGNNRTFVRDLSRIKPSQNTETLELLLKEFFEYFGN FAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVD LARESAWILQQEDTDRPSISSNRPWGLVSLLLPSAPNRKSFTKKKNNKFA IETVKNLLESLKGNRTENFTKTSGKRTISTQT
    • Amino acids
      1 to 582
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0610027A18Rik
    • AW551379
    • EC 2.7.7.19
    • FLJ10486
    • mitochondrial
    • Mitochondrial poly(A) polymerase
    • mtPAP
    • PAP
    • PAP-associated domain-containing protein 1
    • PAPD1
    • PAPD1_HUMAN
    • Poly(A) RNA polymerase
    • Poly(A) RNA polymerase, mitochondrial
    • Poly(A) RNA polymerase, mitochondrial precursor
    • Polynucleotide adenylyltransferase
    • RP11-305E6.3
    • Terminal uridylyltransferase 1
    • TUTase 1
    see all
  • Function
    Polymerase that creates the 3' poly(A) tail of mitochondrial transcripts. Can use all four nucleotides, but has higher activity with ATP and UTP (in vitro). Plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylation of mature histone mRNAs before their degradation is initiated. Might be responsible for the creation of some UAA stop codons which are not encoded in mtDNA.
  • Tissue specificity
    Ubiquitous, with stronger expression in tissues with high energy requirements: heart, brain, and skeletal muscle.
  • Involvement in disease
    Defects in MTPAP are the cause of spastic ataxia autosomal recessive type 4 (SPAX4) [MIM:613672]. A slowly progressive neurodegenerative disease characterized by cerebellar ataxia, spastic paraparesis, dysarthria, and optic atrophy. Note=Affected individuals exhibit a drastic decrease in poly(A) tail length of representative mitochondrial mRNA transcripts, including COX1 and RNA14 (PubMed:20970105).
  • Sequence similarities
    Belongs to the DNA polymerase type-B-like family.
    Contains 1 PAP-associated domain.
  • Cellular localization
    Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • ab162984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up