Description

  • Product name

    Recombinant Human MTRF1L protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ AGSEAHLKVRRPELLAVIKLLNEKERELRETEHLLHDENEDLRKLAENEI TLCQKEITQLKHQIILLLVPSEETDENDLILEVTAGVGGQEAMLFTSEIF DMYQQYAAFKRWHFETLEYFPSELGGLRHASASIGGSEAYRHMKFEGGVH RVQRVPKTEKQGRVHTSTMTVAILPQPTEINLVINPKDLRIDTKRASGAG GQHVNTTDSAVRIVHLPTDWK
    • Amino acids

      1 to 271
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HMRF1L
    • Human mitochondrial release factor 1-like
    • Mitochondrial release factor 1 like
    • Mitochondrial translational release factor 1 like
    • Mitochondrial translational release factor 1-like
    • mtRF1a
    • MTRF1L
    • Peptide chain release factor 1-like, mitochondrial
    • RF1ML_HUMAN
    see all
  • Function

    Mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.
  • Tissue specificity

    Expressed in skeletal muscle (at protein level).
  • Sequence similarities

    Belongs to the prokaryotic/mitochondrial release factor family.
  • Post-translational
    modifications

    Methylation of glutamine in the GGQ triplet is conserved from bacteria to mammals.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab162766 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up