Description

  • Product name

    Recombinant Human MTRR/MSR protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTET APLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSE YTYFCNGGKI
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as MTRR. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • [methionine synthase] cobalamin methyltransferase (cob(II)alamin reducing)
    • 5 methyltetrahydrofolate homocysteine methyltransferase reductase
    • cblE
    • Methionine synthase reductase
    • Methionine synthase reductase, mitochondrial
    • MGC129643
    • MSR
    • MTRR
    see all
  • Relevance

    MTRR/MSR is involved in the reductive regeneration of cob(I)alamin cofactor required for the maintenance of methionine synthase in a functional state.
  • Cellular localization

    Cytoplasmic

Images

  • ab158933 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up