Overview

  • Product name

    Recombinant Human mtTFA protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQ NPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQL TPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQ EAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQ MIEVGRKDLLRRTIKKQRKYGAEEC
    • Molecular weight

      27 kDa including tags
    • Amino acids

      43 to 246
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab103784 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 1.16% Sodium chloride, 20% Glycerol, 0.316% Tris HCl, 0.077% DTT

General Info

  • Alternative names

    • anscription factor 6-like 1
    • Mitochondrial transcription factor 1
    • mitochondrial transcription factor A
    • MtTF1
    • mtTFA
    • TCF 6
    • TCF-6
    • TCF6
    • TCF6L1
    • TCF6L2
    • TCF6L3
    • TFAM
    • TFAM_HUMAN
    • Transcription factor 6
    • Transcription factor 6 like 2
    • Transcription factor 6 like 2 (mitochondrial transcription factor)
    • Transcription factor 6-like 2
    • transcription factor 6-like 3
    • Transcription factor A, mitochondrial
    • Transcription factor A, mitochondrial precursor
    see all
  • Function

    Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind and bend DNA. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA. target DNA. Interacts with TFB1M and TFB2M.
  • Sequence similarities

    Contains 2 HMG box DNA-binding domains.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103784.

References

ab103784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up