Description

  • Product name

    Recombinant Human MUC1 protein
    See all MUC1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSG
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      1095 to 1140
    • Tags

      His tag N-Terminus
    • Additional sequence information

      His tag is 4kDa, Fusion protein size is 10 kDa.

Specifications

Our Abpromise guarantee covers the use of ab80082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: PBS

  • Reconstitution
    Redissolve the powder with 1ml sterile water.

General Info

  • Alternative names

    • ADMCKD
    • ADMCKD1
    • Breast carcinoma associated antigen DF3
    • Breast carcinoma-associated antigen DF3
    • CA 15-3
    • CA15 3
    • CA15 3 antigen
    • CA15-3
    • CA15.3
    • Cancer antigen 15-3
    • Carcinoma associated mucin
    • Carcinoma-associated mucin
    • CD 227
    • CD227
    • DF3 antigen
    • EMA
    • Episialin
    • Epithelial Membrane Antigen
    • H23 antigen
    • H23AG
    • KL 6
    • KL-6
    • KL6
    • Krebs von den Lungen-6
    • MAM 6
    • MAM6
    • MCD
    • MCKD
    • MCKD1
    • Medullary cystic kidney disease 1 (autosomal dominant)
    • Medullary cystic kidney disease, autosomal dominant
    • MUC 1
    • MUC-1
    • MUC-1/SEC
    • MUC-1/X
    • MUC1
    • MUC1-alpha
    • MUC1-beta
    • MUC1-CT
    • MUC1-NT
    • MUC1/ZD
    • MUC1_HUMAN
    • Mucin 1
    • Mucin 1 cell surface associated
    • Mucin 1 transmembrane
    • Mucin 1, cell surface associated
    • Mucin-1 subunit beta
    • Peanut reactive urinary mucin
    • Peanut-reactive urinary mucin
    • PEM
    • PEMT
    • Polymorphic epithelial mucin
    • PUM
    • Tumor associated epithelial membrane antigen
    • Tumor associated epithelial mucin
    • Tumor associated mucin
    • Tumor-associated epithelial membrane antigen
    • Tumor-associated mucin
    see all
  • Function

    The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.
    The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.
  • Tissue specificity

    Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform Y is expressed in tumor cells only.
  • Involvement in disease

    MUC1/CA 15-3 is used as a serological clinical marker of breast cancer to monitor response to breast cancer treatment and disease recurrence (PubMed:20816948). Decreased levels over time may be indicative of a positive response to treatment. Conversely, increased levels may indicate disease progression. At an early stage disease, only 21% of patients exhibit high MUC1/CA 15-3 levels, that is why CA 15-3 is not a useful screening test. Most antibodies target the highly immunodominant core peptide domain of 20 amino acid (APDTRPAPGSTAPPAHGVTS) tandem repeats. Some antibodies recognize glycosylated epitopes.
    Medullary cystic kidney disease 1
  • Sequence similarities

    Contains 1 SEA domain.
  • Developmental stage

    During fetal development, expressed at low levels in the colonic epithelium from 13 weeks of gestation.
  • Post-translational
    modifications

    Highly glycosylated (N- and O-linked carbohydrates and sialic acid). O-glycosylated to a varying degree on serine and threonine residues within each tandem repeat, ranging from mono- to penta-glycosylation. The average density ranges from about 50% in human milk to over 90% in T47D breast cancer cells. Further sialylation occurs during recycling. Membrane-shed glycoproteins from kidney and breast cancer cells have preferentially sialyated core 1 structures, while secreted forms from the same tissues display mainly core 2 structures. The O-glycosylated content is overlapping in both these tissues with terminal fucose and galactose, 2- and 3-linked galactose, 3- and 3,6-linked GalNAc-ol and 4-linked GlcNAc predominating. Differentially O-glycosylated in breast carcinomas with 3,4-linked GlcNAc. N-glycosylation consists of high-mannose, acidic complex-type and hybrid glycans in the secreted form MUC1/SEC, and neutral complex-type in the transmembrane form, MUC1/TM.
    Proteolytic cleavage in the SEA domain occurs in the endoplasmic reticulum by an autoproteolytic mechanism and requires the full-length SEA domain as well as requiring a Ser, Thr or Cys residue at the P + 1 site. Cleavage at this site also occurs on isoform MUC1/X but not on isoform MUC1/Y. Ectodomain shedding is mediated by ADAM17.
    Dual palmitoylation on cysteine residues in the CQC motif is required for recycling from endosomes back to the plasma membrane.
    Phosphorylated on tyrosines and serine residues in the C-terminal. Phosphorylation on tyrosines in the C-terminal increases the nuclear location of MUC1 and beta-catenin. Phosphorylation by PKC delta induces binding of MUC1 to beta-catenin/CTNNB1 and thus decreases the formation of the beta-catenin/E-cadherin complex. Src-mediated phosphorylation inhibits interaction with GSK3B. Src- and EGFR-mediated phosphorylation on Tyr-1229 increases binding to beta-catenin/CTNNB1. GSK3B-mediated phosphorylation on Ser-1227 decreases this interaction but restores the formation of the beta-cadherin/E-cadherin complex. On T-cell receptor activation, phosphorylated by LCK. PDGFR-mediated phosphorylation increases nuclear colocalization of MUC1CT and CTNNB1.
    The N-terminal sequence has been shown to begin at position 24 or 28.
  • Cellular localization

    Secreted; Cell membrane. Cytoplasm. Nucleus. On EGF and PDGFRB stimulation, transported to the nucleus through interaction with CTNNB1, a process which is stimulated by phosphorylation. On HRG stimulation, colocalizes with JUP/gamma-catenin at the nucleus and Apical cell membrane. Exclusively located in the apical domain of the plasma membrane of highly polarized epithelial cells. After endocytosis, internalized and recycled to the cell membrane. Located to microvilli and to the tips of long filopodial protusions.
  • Information by UniProt

Images

  • 20% SDS PAGE showing ab80082 at approximately 10kDa.

References

ab80082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for contacting Abcam.

We have many antibodies against MUC1 in our catalogue, I have searched and found a few that may work for you, please see below:

https://www.abcam.com/MUC1-antibody-ab15481.html
https://www.abcam.com/MUC1-antibody-ab62687.html
https://www.abcam.com/MUC1-antibody-C595-NCRC48-ab28081.html
https://www.abcam.com/MUC1-antibody-M9E7-ab8322.html



If none of the above work there are another 40 primary MUC antibodies in our catalogue that you could search to see if any of those would work. Also I know that you said that you would prefer a Rb polyclonal that would not react with mouse and human, however I could not find one that met that criteria.

Weare able to ship to Romania and I am not sure of the exact shipping times, however this would be confirmed with you when you are completing the purchase. We do aim to ship all of our products overnight on an ice pack and so the only delay would be if the product that you wanted was out of stock.

Please let me know if there is anything else I can help you with.

Read More

Answer

Thank you for your inquiry.

Unfortunately, we do not offer a MUC1 fulllength protein. The MUC1 protein (ab80082) is only a recombinant fragment and all others are peptides. I am sorry for the inconvenience but I cannot recommend any of these as positive control for your experiment.

The immunogen for ab28081 washuman Urinary MUC-1 mucin.I am happy to confirm that the epitopethis clone ([C595 (NCRC48)])recognizes was mapped to the peptide epitope ARG-PRO-ALA-PRO within the protein core of the mucin. The epitope sequence RPAP is a repeated motif that occurs about 40 times along the length of the protein (between residues 126 to 965).

I am sorry that I could not answer all your questions on this occasion and hope this information was helpful nevertheless.

Read More

Answer

Thank you for your inquiry and I sincerely apologize for the delay. I was in contact with the supplying lab and unfortunately we are not able to provide a custom preparation of this protein at this time. We also do not know if the MUC1 would bind to its aptamer as this has not been specifically tested. I am sorry that this information could not be more helpful but please let us know if you have any other questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up