Overview

  • Product name

    Recombinant Human MUC4 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNG QIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQ EYETFYGEHS
    • Molecular weight

      38 kDa

Specifications

Our Abpromise guarantee covers the use of ab130768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.307% Glutathione, 1.24% Tris HCl

General Info

  • Alternative names

    • Ascites sialoglycoprotein
    • Ascites sialoglycoprotein 1
    • Ascites sialoglycoprotein 2
    • ASGP
    • ASGP-1
    • ASGP-2
    • HSA276359
    • MUC 4
    • MUC-4
    • Muc4
    • MUC4_HUMAN
    • Mucin 4
    • Mucin 4 cell surface associated
    • Mucin 4 tracheobronchial
    • Mucin-4 beta chain
    • Pancreatic adenocarcinoma mucin
    • Testis mucin
    • Tracheobronchial mucin
    • Tracheobronchial mucin Fragment
    see all
  • Function

    May play a role in tumor progression. Ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. Has anti-adhesive properties. Seems to alter cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and in its ability to act as an intramembrane ligand for ERBB2. Plays an important role in cell proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. The MUC4-ERBB2 complex causes site-specific phosphorylation of the ERBB2 'Tyr-1248'. In polarized epithelilal cells segragates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation.
  • Tissue specificity

    Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines.
  • Sequence similarities

    Contains 1 AMOP domain.
    Contains 2 EGF-like domains.
    Contains 1 NIDO domain.
    Contains 1 VWFD domain.
  • Developmental stage

    Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation.
  • Post-translational
    modifications

    Proteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain.
    mucrnin-4 alpha chain is highly O-glycosylated.
    mucin-4 beta chain is predominantly N-glycosylated.
  • Cellular localization

    Secreted; Cell membrane and Membrane. Secreted. Isoforms lacking the Cys-rich region, EGF-like domains and transmembrane region are secreted. Secretion occurs by splicing or proteolytic processing.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab130768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for your patience.
The immunogen has now been added to our catalog as ab130768.
https://www.abcam.com/index.html?datasheet=130768
This is the immunogen (protein fragment) that was used to raise antibody ab60720.
If you would order the item today, you would receive it in 2-3 weeks.
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up