Recombinant Human MUC4 protein (ab130768)
Key features and details
- Expression system: Wheat germ
- Purity: >= 80% Purified via GST Tag
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human MUC4 protein
See all MUC4 proteins and peptides -
Purity
>= 80 % Purified via GST Tag.
Glutathione Sepharose -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNG QIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQ EYETFYGEHS -
Predicted molecular weight
38 kDa
-
Specifications
Our Abpromise guarantee covers the use of ab130768 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8
Constituents: 0.307% Glutathione, 1.24% Tris HCl
General Info
-
Alternative names
- Ascites sialoglycoprotein
- Ascites sialoglycoprotein 1
- Ascites sialoglycoprotein 2
see all -
Function
May play a role in tumor progression. Ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. Has anti-adhesive properties. Seems to alter cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and in its ability to act as an intramembrane ligand for ERBB2. Plays an important role in cell proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. The MUC4-ERBB2 complex causes site-specific phosphorylation of the ERBB2 'Tyr-1248'. In polarized epithelilal cells segragates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. -
Tissue specificity
Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines. -
Sequence similarities
Contains 1 AMOP domain.
Contains 2 EGF-like domains.
Contains 1 NIDO domain.
Contains 1 VWFD domain. -
Developmental stage
Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation. -
Post-translational
modificationsProteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain.
mucrnin-4 alpha chain is highly O-glycosylated.
mucin-4 beta chain is predominantly N-glycosylated. -
Cellular localization
Secreted; Cell membrane and Membrane. Secreted. Isoforms lacking the Cys-rich region, EGF-like domains and transmembrane region are secreted. Secretion occurs by splicing or proteolytic processing. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab130768 has not yet been referenced specifically in any publications.