Description

  • Product name

    Recombinant Human MUM1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF RIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCA LNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSH PYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGP RGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDC RLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLLPYPEDNGQ RKNIEKLLSHLERGVVPWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKL ITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQ E
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 451

Specifications

Our Abpromise guarantee covers the use of ab132104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Interferon regulatory factor 4
    • IRF 4
    • IRF-4
    • Irf4
    • IRF4_HUMAN
    • LSIRF
    • Lymphocyte specific interferon regulatory factor
    • Lymphocyte specific IRF
    • Lymphocyte-specific interferon regulatory factor
    • Multiple myeloma oncogene 1
    • MUM 1
    • MUM1
    • NF EM5
    • NF-EM5
    • NFEM5
    • PU.1 interaction partner
    • Sfpi1/PU.1 interaction partner
    • Transcriptional activator PIP
    see all
  • Function

    Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.
  • Tissue specificity

    Lymphoid cells.
  • Involvement in disease

    Defects in IRF4 are a cause of multiple myeloma (MM) [MIM:254500]. MM is a malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia. Note=A chromosomal aberration involving IRF4 is found in multiple myeloma. Translocation t(6;14)(p25;q32) with the IgH locus.
  • Sequence similarities

    Belongs to the IRF family.
    Contains 1 IRF tryptophan pentad repeat DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132104.

References

ab132104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up