Overview

  • Product name

    Recombinant Human Munc18-2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAPSGLKAVVGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDI LAEGITIVEDINKRREPIPSLEAIYLLSPTEKALIKDFQGTPTFTYKAAH IFFTDTCPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHST YNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAH AVLAKLNAFKADTPSLGEGPEKTRSQLLIMDRAADPVSPLLHELTFQAMA YDLLDIEQDTYRYETTGLSEAREKAVLLDEDDDLWVELRHMHIADVSKKV TELLRTFCESKRLTTDKANIKDLSQILKKMPQYQKELNKYSTHLHLADDC MKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYDK IRVLLLYILLRNGVSEENLAKLIQHANVQAHSSLIRNLEQLGGTVTNPGG SGTSSRLEPRERMEPTYQLSRWTPVIKDVMEDAVEDRLDRNLWPFVSDPA PTASSQAAVSARFGHWHKNKAGIEARAGPRLIVYVMGGVAMSEMRAAYEV TRATEGKWEVLIGSSHILTPTRFLDDLKALDKKLEDIALP
    • Amino acids

      1 to 590
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as STXBP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FHL5
    • Hunc18b
    • MUNC18 2
    • pp10122
    • Protein unc-18 homolog 2
    • Protein unc-18 homolog B
    • STXB2_HUMAN
    • Stxbp2
    • syntaxin binding protein 2
    • Syntaxin-binding protein 2
    • Unc-18B
    • UNC18 2
    • Unc18-2
    • UNC18B
    see all
  • Function

    Involved in intracellular vesicle trafficking and vesicle fusion with membranes. Contributes to the granule exocytosis machinery through interaction with soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) proteins that regulate membrane fusion. Regulates cytotoxic granule exocytosis in natural killer (NK) cells.
  • Tissue specificity

    Placenta, lung, liver, kidney and pancreas, as well as in peripheral blood lymphocytes.
  • Involvement in disease

    Defects in STXBP2 are the cause of hemophagocytic lymphohistiocytosis familial type 5 (FHL5) [MIM:613101]. FHL5 is rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia.
  • Sequence similarities

    Belongs to the STXBP/unc-18/SEC1 family.
  • Information by UniProt

Images

  • ab159608 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up