Overview

  • Product name

    Recombinant Human Muscarinic Acetylcholine Receptor M5/CHRM5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGK ESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYK FRLVVKADGN
    • Amino acids

      281 to 390
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Muscarinic Acetylcholine Receptor M5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acetylcholine receptor muscarinic 5
    • AChR
    • AChR M5
    • ACM5_HUMAN
    • CHKM5MR
    • Cholinergic receptor muscarinic 5
    • Chrm 5
    • Chrm5
    • HM 5
    • HM5
    • m5
    • M5R
    • MGC41838
    • Muscarinic acetylcholine receptor M5
    see all
  • Function

    The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM5 sub-subfamily.
  • Cellular localization

    Cell membrane. Cell junction, synapse, postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab152278 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up