Overview

  • Product name
    Recombinant Human MVB12B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPI TGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSF SKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKF IPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDS SQPTTPSQSSAASTPAPNLPR
    • Amino acids
      1 to 221
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as FAM125B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C9orf28
    • Chromosome 9 open reading frame 28
    • ESCRT-I complex subunit MVB12B
    • F125B_HUMAN
    • Fam125b
    • Family with sequence similarity 125 member B
    • FLJ00001
    • Multivesicular body subunit 12B
    • MVB12B
    • Protein FAM125B
    see all
  • Function
    Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies.
  • Sequence similarities
    Belongs to the FAM125 family.
    Contains 1 MABP domain.
    Contains 1 UMA domain.
  • Cellular localization
    Endosome. Late endosome membrane.
  • Information by UniProt

Images

  • ab164784 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up