Overview

  • Product name

    Recombinant Human MVP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM VTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLY PGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGDEWLFEGPGT YIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTT VGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWL VTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKR VVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVS HQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRA VIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLA PRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSL SAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVN DRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIR TAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRT RDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAE KARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQA LAIETEAELQRVQKVRELELVYARAQLELEVSKAQQLAEVEVKKFKQMTE AIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPINLFNTAFGLLG MGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR
    • Amino acids

      1 to 893
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • LRP
    • Lung resistance related protein
    • Lung resistance-related protein
    • Major vault protein
    • Major vault protein, rat, homolog of
    • MVP
    • MVP_HUMAN
    • testicular secretory protein Li 30
    • VAULT 1
    • VAULT1
    see all
  • Function

    Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.
  • Tissue specificity

    Present in most normal tissues. Higher expression observed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine. Overexpressed in many multidrug-resistant cancer cells.
  • Sequence similarities

    Contains 9 MVP (vault) repeats.
  • Domain

    MVP 3 mediates interaction with PTEN.
    MVP 4 mediates interaction with PARP4.
  • Post-translational
    modifications

    Phosphorylated on Tyr residues after EGF stimulation.
    Dephosphorylated by PTPN11.
  • Cellular localization

    Cytoplasm. Nucleus > nuclear pore complex. 5% found in the nuclear pore complex. Translocates from the nucleus to the cytoplasm upon EGF treatment.
  • Information by UniProt

Images

  • ab153030 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up