Description

  • Product name

    Recombinant Human MYBPC3 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDIS ASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKA EPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAP DDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLS SKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCS NFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK KRDSFRTPRDSKLEAPAEEDVWEILRQA
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      1 to 328
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • C protein cardiac muscle isoform
    • C-protein
    • cardiac muscle isoform
    • Cardiac MyBP C
    • Cardiac MyBP-C
    • Cardiac myosin binding protein C
    • cardiac-type
    • CMH4
    • FHC
    • MYBP C
    • MYBPC
    • MYBPC3
    • Myosin binding protein C cardiac
    • Myosin binding protein C cardiac-type
    • Myosin-binding protein C
    • myosin-binding protein C cardiac type
    • MYPC3_HUMAN
    see all
  • Function

    Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
  • Involvement in disease

    Defects in MYBPC3 are the cause of cardiomyopathy familial hypertrophic type 4 (CMH4) [MIM:115197]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. MyBP family.
    Contains 3 fibronectin type-III domains.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Substrate for phosphorylation by PKA and PKC. Reversible phosphorylation appears to modulate contraction.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225662 with 5% enrichment gel and 15% separation gel.

References

ab225662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up