Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRPDRAEAPGPPAM AAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALA EEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDV LLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLD DPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPG TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR LIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
    • Molecular weight

      39 kDa including tags
    • Amino acids

      1 to 309
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Mutant myeloid differentiation primary response 88
    • MYD 88
    • Myd88
    • MYD88_HUMAN
    • MYD88D
    • Myeloid differentiation marker 88
    • Myeloid differentiation primary response 88
    • Myeloid differentiation primary response gene
    • Myeloid differentiation primary response gene (88)
    • Myeloid differentiation primary response gene 88
    • Myeloid differentiation primary response protein MyD88
    • OTTHUMP00000161718
    • OTTHUMP00000208595
    • OTTHUMP00000209058
    • OTTHUMP00000209059
    • OTTHUMP00000209060
    see all
  • Function

    Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in MYD88 are the cause of MYD88 deficiency (MYD88D) [MIM:612260]; also known as recurrent pyogenic bacterial infections due to MYD88 deficiency. Patients suffer from autosomal recessive, life-threatening, often recurrent pyogenic bacterial infections, including invasive pneumococcal disease, and die between 1 and 11 months of age. Surviving patients are otherwise healthy, with normal resistance to other microbes, and their clinical status improved with age.
  • Sequence similarities

    Contains 1 death domain.
    Contains 1 TIR domain.
  • Domain

    The intermediate domain (ID) is required for the phosphorylation and activation of IRAK.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139225.

References

ab139225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up