Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA QISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
    • Amino acids

      646 to 745
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 84 kDa myeloperoxidase
    • 89 kDa myeloperoxidase
    • EC 1.11.1.7
    • EC1.11.2.2
    • fj80f04
    • MPO
    • mpx
    • myeloid-specific peroxidase
    • Myeloperoxidase
    • Myeloperoxidase heavy chain
    • Myeloperoxidase light chain
    • PERM_HUMAN
    • wu:fj80f04
    see all
  • Function

    Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity.
  • Involvement in disease

    Defects in MPO are the cause of myeloperoxidase deficiency (MPD) [MIM:254600]. MPD is an autosomal recessive defect that results in disseminated candidiasis.
  • Sequence similarities

    Belongs to the peroxidase family. XPO subfamily.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • ab158915 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up