Description

  • Product name

    Recombinant Human MYO1D protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVN PYKLLNIYGRDTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVI SGESGAGKTEASKYIMQYIAAITNPSQRAEVERVKNMLLKSNCVLEAFGN AKTNRNDNSSRFGKYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERS FHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSSINDAAEFRVV ADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSII AELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYER LFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCI NYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHVGLL
    • Amino acids

      1 to 436
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0727
    • Myosin I gamma
    • Myosin Id
    • MYR4
  • Relevance

    Myosins are actin based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Images

  • ab158941 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up