Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMR LRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS
    • Amino acids
      1758 to 1853
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dilute myosin heavy chain
    • GS1
    • MYH12
    • MYO5
    • Myo5a
    • MYO5A_HUMAN
    • Myosin heavy chain 12
    • Myosin heavy polypeptide kinase
    • Myosin V
    • Myosin VA (heavy polypeptide 12 myoxin)
    • Myosin-12
    • Myoxin
    • MYR12
    • non-muscle
    • Unconventional myosin-Va
    see all
  • Function
    Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. Involved in melanosome transport. Also mediates the transport of vesicles to the plasma membrane. May also be required for some polarization process involved in dendrite formation.
  • Tissue specificity
    Detected in melanocytes.
  • Involvement in disease
    Griscelli syndrome 1
    Griscelli syndrome 3
    Elejalde syndrome
  • Sequence similarities
    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family.
    Contains 1 dilute domain.
    Contains 6 IQ domains.
    Contains 1 myosin motor domain.
  • Information by UniProt

Images

  • ab158944 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up