Description

  • Product name

    Recombinant Human MYO6 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLT RKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1188 to 1285

Specifications

Our Abpromise guarantee covers the use of ab152554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deafness autosomal recessive 37
    • DFNA 22
    • DFNA22
    • DFNB 37
    • DFNB37
    • KIAA0389
    • MYO 6
    • Myo6
    • MYO6_HUMAN
    • Myosin VI
    • Myosin-VI
    • Myosin6
    • Unconventional myosin-6
    • Unconventional myosin-VI
    see all
  • Function

    Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Myosin 6 is a reverse-direction motor protein that moves towards the minus-end of actin filaments. Has slow rate of actin-activated ADP release due to weak ATP binding. Functions in a variety of intracellular processes such as vesicular membrane trafficking and cell migration. Required for the structural integrity of the Golgi apparatus via the p53-dependent pro-survival pathway. Appears to be involved in a very early step of clathrin-mediated endocytosis in polarized epithelial cells. May act as a regulator of F-actin dynamics. May play a role in transporting DAB2 from the plasma membrane to specific cellular targets. Required for structural integrity of inner ear hair cells.
  • Tissue specificity

    Expressed in most tissues examined including heart, brain, placenta, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in brain, pancreas, testis and small intestine. Also expressed in fetal brain and cochlea. Isoform 1 and isoform 2, containing the small insert, and isoform 4, containing neither insert, are expressed in unpolarized epithelial cells.
  • Involvement in disease

    Defects in MYO6 are the cause of deafness autosomal dominant type 22 (DFNA22) [MIM:606346]. DFNA22 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNA22 is progressive and postlingual, with onset during childhood. By the age of approximately 50 years, affected individuals invariably have profound sensorineural deafness.
    Defects in MYO6 are the cause of deafness autosomal recessive type 37 (DFNB37) [MIM:607821].
    Defects in MYO6 are the cause of deafness sensorineural with hypertrophic cardiomyopathy (DFNHCM) [MIM:606346].
  • Sequence similarities

    Contains 1 IQ domain.
    Contains 1 myosin head-like domain.
  • Domain

    Divided into three regions: a N-terminal motor (head) domain, followed by a neck domain consisting of a calmodulin-binding linker domain and a single IQ motif, and a C-terminal tail region with a coiled-coil and a unique globular domain required for interaction with other proteins.
  • Post-translational
    modifications

    Phosphorylation in the motor domain, induced by EGF, results in translocation of MYO6 from the cell surface to membrane ruffles and affects F-actin dynamics. Phosphorylated in vitro by p21-activated kinase (PAK).
  • Cellular localization

    Cytoplasmic vesicle > clathrin-coated vesicle membrane; Cytoplasmic vesicle > clathrin-coated vesicle membrane. Cell projection > ruffle membrane and Golgi apparatus > trans-Golgi network membrane. Golgi apparatus. Nucleus. Cytoplasm > perinuclear region. Membrane > clathrin-coated pit. Cell projection > ruffle membrane. Also present in endocyctic vesicles, and membrane ruffles. Translocates from membrane ruffles, endocytic vesicles and cytoplasm to Golgi apparatus, perinuclear membrane and nucleus through induction by p53 and p53-induced DNA damage. Recruited into membrane ruffles from cell surface by EGF-stimulation. Colocalizes with DAB2 in clathrin-coated pits/vesicles. Colocalizes with OPTN at the Golgi complex and in vesicular structures close to the plasma membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152554 stained with Coomassie Blue.

References

ab152554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up