Description

  • Product name

    Recombinant Human MYO9B protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAF RRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEEL
    • Amino acids

      201 to 290
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CELIAC 4
    • Celiac disease 4
    • CELIAC4
    • MYO 9B
    • Myosin 9B
    • Myosin IX
    • Myosin IXB
    • Myosin9B
    • MyosinIX
    • MyosinIXB
    • MYR 5
    • MYR5
    • Unconventional myosin 9b
    see all
  • Relevance

    Myosin IX belongs to the family of unconventional myosins, distinct from the classical myosins I and myosins II. Myosin IX, thought to be involved in signal transduction and leukocyte differentiation, includes several isoforms. The rat isoforms are myosin IX/Myr5 (230 kDa) and Myr7 (300 kDa), and the human isoforms are myosin IXa (MYO9A) and myosin IXb (MYO9B). The isoforms of myosin IX have similar overall domain structure and are expressed in many tissues and cell types, although they have distinct tissue expression patterns. The subcellular localization of class IX myosins appears to be partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. The expression level of myosins IX may vary during development and differentiation.
  • Cellular localization

    Cytoplasm; cell cortex. Cytoplasm; perinuclear region. Note=In undifferentiated cells colocalizes with F-actin in the cell periphery while in differentiated cells its localization is cytoplasmic with the highest levels in the perinuclear region.

Images

  • ab158946 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up