Description

  • Product name

    Recombinant Human MyoD1 protein
    See all MyoD1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab134857 was expressed in E.coli, refolded, chromatographically purified and sterile filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      29aa_Tag_ELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRF FEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGR CLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQ RLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEH YSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGK SAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGE SSGDPTQSPDAAPQCPAGANPNPIYQVLLEESGGGGSPGRRRRRRRRRRR
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      2 to 320

Specifications

Our Abpromise guarantee covers the use of ab134857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Buffer contains a proprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol.

General Info

  • Alternative names

    • bHLHc1
    • Class C basic helix-loop-helix protein 1
    • MYF 3
    • Myf-3
    • MYF3
    • Myoblast determination protein 1
    • MYOD
    • Myod 1
    • MYOD1
    • MYOD1_HUMAN
    • Myogenic differentiation 1
    • Myogenic factor 3
    • Myogenic factor MYF 3
    • Myogenin D1
    • PUM
    see all
  • Function

    Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates muscle-specific promoters. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications

    Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function.
    Ubiquitinated on the N-terminus; which is required for proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134857 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up