Overview

  • Product name

    Recombinant Human Myoneurin protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      CELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLS ETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSE PQLIFLQQLY
    • Amino acids

      501 to 610
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MYNN
    • MYNN_HUMAN
    • Myoneurin
    • OSZF
    • SBBIZ1
    • ZBTB31
    • Zinc finger and BTB domain containing protein 31
    • Zinc finger and BTB domain-containing protein 31
    • Zinc finger protein with BTB/POZ domain
    • ZNF902
    see all
  • Tissue specificity

    Mainly expressed in the neuromuscular system. Located in and around synaptic myonuclei in adult muscle. Expression is dysregulated after nerve injury. Also found in the testis, ovary and placenta.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 8 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab163267 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up