Overview

  • Product name
    Recombinant Human Myosin Phosphatase 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRG SPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACI DENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASV GIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDAR QWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDG WTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEM EEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
    • Amino acids
      1 to 386
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Myosin Phosphatase 2
    • Myosin phosphatase regulatory subunit
    • Myosin phosphatase targeting subunit 2
    • Myosin phosphatase, target subunit 2
    • MYPT2
    • PP1bp55
    • PPP1R12B
    • Protein phosphatase 1 regulatory subunit 12B
    • Protein phosphatase 1, regulatory (inhibitor) subunit 12B
    see all
  • Relevance
    Myosin light chain phosphatase (MLCP) consists of three subunits- catalytic subunit, large subunit/myosin binding subunit (MBS) and small subunit (sm-M20). This gene is a multi-functional gene which encodes both MBS and sm-M20. MLCP regulates myosins and the dephosphorylation is enhanced by the presence of MBS. The sm-M20 is suggested to play a regulatory role in muscle contraction by binding to MBS. MBS is also encoded by another gene, myosin light chain phosphatase target subunit 1. sm-M20 shows higher binding affinity to this gene product than to myosin light chain phosphatase target subunit 2-MBS even though the two MBS proteins are highly similar. Although both MBSs increase the activity of MLCP, myosin light chain phosphatase target subunit 1-MBS is a more efficient activator. There are four alternatively spliced transcript variants described; two alter the MBS coding region and two alter the sm-M20 coding region of this gene.
  • Cellular localization
    Cytoplasmic

Images

  • ab158947 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up