Recombinant Human Myozenin 2 protein (ab162665)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKRVSIPRDIMLEELSHL SNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGG SQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQS PWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASR MVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITT EPTDDTTVPESEDL
    • Amino acids
      1 to 264
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C4orf5
    • Calcineurin binding protein calsarcin 1
    • Calsarcin 1
    • Calsarcin-1
    • Calsarcin1
    • CMH16
    • CS 1
    • CS1
    • FATZ related protein 2
    • FATZ-related protein 2
    • Muscle specific protein
    • MYOZ 2
    • MYOZ2
    • MYOZ2_HUMAN
    • Myozenin-2
    • Myozenin2
    see all
  • Function
    Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.
  • Tissue specificity
    Expressed specifically in heart and skeletal muscle.
  • Involvement in disease
    Defects in MYOZ2 are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16) [MIM:613838]. CMH16 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities
    Belongs to the myozenin family.
  • Cellular localization
    Cytoplasm > myofibril > sarcomere > Z line. Colocalizes with ACTN1 and PPP3CA at the Z-line of heart and skeletal muscle.
  • Information by UniProt

Images

  • ab162665 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up