Recombinant Human Myozenin 2 protein (ab169888)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: T7 tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Myozenin 2 protein
See all Myozenin 2 proteins and peptides -
Purity
> 90 % SDS-PAGE.
The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGEFMLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKK VSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSI AMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIP PEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSF NRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRT PKGWISENIPIVITTEPTDDTTVPESEDL -
Predicted molecular weight
30 kDa -
Amino acids
1 to 264 -
Tags
T7 tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab169888 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.
General Info
-
Alternative names
- C4orf5
- Calcineurin binding protein calsarcin 1
- Calsarcin 1
see all -
Function
Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis. -
Tissue specificity
Expressed specifically in heart and skeletal muscle. -
Involvement in disease
Defects in MYOZ2 are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16) [MIM:613838]. CMH16 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. -
Sequence similarities
Belongs to the myozenin family. -
Cellular localization
Cytoplasm > myofibril > sarcomere > Z line. Colocalizes with ACTN1 and PPP3CA at the Z-line of heart and skeletal muscle. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab169888 has not yet been referenced specifically in any publications.