Description

  • Product name

    Recombinant Human Myozenin 2 protein
    See all Myozenin 2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFMLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKK VSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSI AMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIP PEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSF NRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRT PKGWISENIPIVITTEPTDDTTVPESEDL
    • Predicted molecular weight

      30 kDa
    • Amino acids

      1 to 264
    • Tags

      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • C4orf5
    • Calcineurin binding protein calsarcin 1
    • Calsarcin 1
    • Calsarcin-1
    • Calsarcin1
    • CMH16
    • CS 1
    • CS1
    • FATZ related protein 2
    • FATZ-related protein 2
    • Muscle specific protein
    • MYOZ 2
    • MYOZ2
    • MYOZ2_HUMAN
    • Myozenin-2
    • Myozenin2
    see all
  • Function

    Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.
  • Tissue specificity

    Expressed specifically in heart and skeletal muscle.
  • Involvement in disease

    Defects in MYOZ2 are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16) [MIM:613838]. CMH16 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities

    Belongs to the myozenin family.
  • Cellular localization

    Cytoplasm > myofibril > sarcomere > Z line. Colocalizes with ACTN1 and PPP3CA at the Z-line of heart and skeletal muscle.
  • Information by UniProt

References

ab169888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up