Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPP TGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVIN VIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRY RIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEG NPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVT DKDQPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNR MFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQ EEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTI AVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVL PQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITR LNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSN GDCTDVDRIVGAGLGTGAHHHHHH
    • Molecular weight

      63 kDa including tags
    • Amino acids

      160 to 724
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_001783).

Specifications

Our Abpromise guarantee covers the use of ab223009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab223009 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 20% Glycerol

General Info

  • Alternative names

    • CADH2_HUMAN
    • Cadherin 2
    • Cadherin 2 N cadherin neuronal
    • Cadherin 2 type 1
    • Cadherin 2 type 1 N cadherin neuronal
    • Cadherin 2, type 1, N-cadherin (neuronal)
    • Cadherin-2
    • Cadherin2
    • Calcium dependent adhesion protein neuronal
    • CD325
    • CD325 antigen
    • CDH2
    • CDHN
    • CDw325
    • CDw325 antigen
    • N cadherin 1
    • N-cadherin
    • NCAD
    • Neural cadherin
    • OTTHUMP00000066304
    • OTTHUMP00000067378
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab223009.

    MWt 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab223009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up