Description

  • Product name

    Recombinant Human n-Myc/MYCN protein
    See all n-Myc/MYCN proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIW KKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG GLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKR EPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHK ALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSS FLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR QQQLLKKIEHARTC
    • Predicted molecular weight

      77 kDa
    • Amino acids

      1 to 464
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.

     This product was previously labelled as n-Myc

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bHLHe37
    • Class E basic helix-loop-helix protein 37
    • MODED
    • mycn
    • MYCN_HUMAN
    • N myc
    • N myc proto oncogene protein
    • N-myc proto-oncogene protein
    • Neuroblastoma derived v myc avian myelocytomatosis viral related oncogene
    • Neuroblastoma MYC oncogene
    • NMYC
    • NMYC proto oncogene protein
    • ODED
    • Oncogene NMYC
    • pp65/67
    • V myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog
    • v myc avian myelocytomatosis viral related oncogene neuroblastoma derived
    • v myc myelocytomatosis viral related oncogene neuroblastoma derived
    see all
  • Function

    May function as a transcription factor.
  • Involvement in disease

    Note=Amplification of the N-MYC gene is associated with a variety of human tumors, most frequently neuroblastoma, where the level of amplification appears to increase as the tumor progresses.
    Defects in MYCN are the cause of microcephaly-oculo-digito-esophageal-duodenal syndrome (MODED) [MIM:164280]; also known as oculodigitoesophagoduodenal syndrome (ODED). Microcephaly-oculo-digito-esophageal-duodenal syndrome is characterized by variable combinations of esophageal and duodenal atresias, microcephaly, learning disability and limb malformations. Cardiac and renal malformations, vertebral anomalies, and deafness have also been described.
    Defects in MYCN are the cause of microcephaly and digital abnormalities with normal intelligence (MCPHDANI) [MIM:602585].
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stage

    Expressed during fetal development.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114325 on a 12.5% gel stained with Coomassie Blue.

References

ab114325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up