Overview

  • Product name

    Recombinant Human NAB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFL EIMALVGMASKPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLP EGSPTWLGISCSSYERSSNAREPHLKIPKCAATTCVQSLGQGKSDVVGSL ALQSVGESRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVA ECVERMAPTLPKSDLNEVKELLKTNKKLAKMIGHIFEMNDDDPHKEEEIR KYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFAL ARQISREVTYKYTYRTTKSKCGERDELSPKRIKVEDGFPDFQDSVQTLFQ QARAKSEELAALSSQQPVKVMAKQMEFLCNQAGYERLQHAERRLSAGLYR QSSEEHSPNGLTSDNSDGQGERPLNLRMPNLQNRQPHHFVVDGELSRLYP SEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR
    • Amino acids

      1 to 487
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EGR 1 binding protein 1
    • EGR-1-binding protein 1
    • EGR1 binding protein 1
    • NAB1
    • NAB1_HUMAN
    • NGFI A binding protein 1
    • NGFI A binding protein 1 (EGR1 binding protein 1)
    • NGFI-A-binding protein 1
    • Transcriptional regulatory protein p54
    see all
  • Function

    Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2.
  • Tissue specificity

    Isoform Short is found in a myeloid leukemia cell line.
  • Sequence similarities

    Belongs to the NAB family.
  • Domain

    The NAB conserved domain 1 (NCD1) interacts with EGR1 inhibitory domain and mediates multimerization.
    The NAB conserved domain 2 (NCD2) is necessary for transcriptional repression.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab158948 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up