Overview

  • Product name

    Recombinant Human NABC1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDL GISVKTDNVATSSPETTEISAVADANGKNL
    • Amino acids

      1 to 80
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AIBC 1
    • AIBC1
    • Amplified and overexpressed in breast cancer
    • BCAS 1
    • BCAS1
    • BCAS1_HUMAN
    • Breast carcinoma amplified sequence 1
    • Breast carcinoma-amplified sequence 1
    • Novel amplified in breast cancer 1
    see all
  • Tissue specificity

    Expressed in brain and prostate, and at lower levels in testis, intestine and colon. Overexpressed in most breast cancer cell lines and down-regulated in some colorectal tumors.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab160082 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up