Overview

  • Product name
    Recombinant Human NaDC-1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQ ALPVTSASSEGRAHLSQKHLHLTQC
    • Amino acids
      146 to 220
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SLC13A2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Na(+) coupled citrate transporter
    • Na(+)/dicarboxylate cotransporter 1
    • NaCT
    • NaDC-1
    • NADC1
    • Renal sodium/dicarboxylate cotransporter
    • SDCT1
    • SLC13A2
    • Solute carrier family 13 (sodium-dependent dicarboxylate transporter) member 2
    • Solute carrier family 13 member 2
    see all
  • Relevance
    SLC13A2 is involved in the cotransport of sodium ions and dicarboxylates such as succinate and citrate.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab160319 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up