Description

  • Product name

    Recombinant Human NADK protein
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSLHGPCPVTTFGPKACVLQNPQTIMHIQD PASQRLTWNK SPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDE SFGAVKKKFC TFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFL TPFSFENFQS QVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMD VGKQAMQYQV LNEVVIDRGPSSYLSN
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      64 to 298
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (up to 6 months). Store at -20°C.

    pH: 7.50
    Constituents: 0.02% DTT, 0.79% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • dJ283E3.1
    • FLJ13052
    • FLJ37724
    • NAD kinase
    • Nadk
    • NADK_HUMAN
    • Poly(P)/ATP NAD kinase
    • PPNK
    • RP1-283E3.6
    see all
  • Tissue specificity

    Widely expressed but not detected in skeletal muscle.
  • Sequence similarities

    Belongs to the NAD kinase family.
  • Information by UniProt

References

ab151382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up