Recombinant Human NADPH oxidase 4 protein (ab112414)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, PepArr, SDS-PAGE, WB
Description
-
Product name
Recombinant Human NADPH oxidase 4 protein
See all NADPH oxidase 4 proteins and peptides -
Biological activity
Checker: see comments on ab112406. -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKL LFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS -
Predicted molecular weight
37 kDa including tags -
Amino acids
479 to 578
-
Specifications
Our Abpromise guarantee covers the use of ab112414 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Peptide Array
SDS-PAGE
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
Glutathione is reduced.
General Info
-
Alternative names
- Kidney oxidase 1
- Kidney oxidase-1
- Kidney superoxide producing NADPH oxidase
see all -
Function
Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. May produce superoxide in the nucleus and play a role in regulating gene expression upon cell stimulation. Isoform 3 is not functional. Isoform 4 displays an increased activity. Isoform 5 and isoform 6 display reduced activity. -
Tissue specificity
Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain tumor cell lines and airway epithelial cells. -
Sequence similarities
Contains 1 FAD-binding FR-type domain.
Contains 1 ferric oxidoreductase domain. -
Developmental stage
Expressed in fetal kidney and fetal liver. -
Post-translational
modificationsIsoform 3 and isoform 4 are N-glycosylated. Isoform 4 glycosylation is required for its proper function. -
Cellular localization
Endoplasmic reticulum membrane. Cell membrane. Cell junction > focal adhesion. Nucleus. May localize to plasma membrane and focal adhesions. According to PubMed:15927447, may also localize to the nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab112414 has not yet been referenced specifically in any publications.