Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICG YGCWDHYYESDTLLHSFQVLAALLESPVTQDIICDVGMPVMHRNVRYNCR VIFLNRKILLIRPKMALANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDL TKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNAS GSHHVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRLYYDGCAMIAM NGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPR VKVDFALSCHEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQA GFLLPLSGGVDSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISY TPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISLNIDPA VKAVMGIFSLVTGKSPLFAAHGGSSRENLALQNVQARIRMVLAYLFAQLS LWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIGGISKTDLRAF VQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSV YGKLRKVAKMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKM TTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQ SLDGVD
    • Amino acids
      1 to 706
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as NAD Synthetase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glutamine dependent NAD(+) synthetase
    • Glutamine-dependent NAD(+) synthetase
    • NAD(+) synthase [glutamine hydrolyzing]
    • NAD(+) synthase [glutamine-hydrolyzing]
    • NAD(+) synthetase
    • NAD(+) synthetase 1
    • NADE_HUMAN
    • nadsyn1
    see all
  • Pathway
    Cofactor biosynthesis; NAD(+) biosynthesis; NAD(+) from deamido-NAD(+) (L-Gln route): step 1/1.
  • Sequence similarities
    In the C-terminal section; belongs to the NAD synthetase family.
    Contains 1 CN hydrolase domain.
  • Information by UniProt

Images

  • ab163006 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up