Description

  • Product name

    Recombinant Human NAGA protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    ab222442 was purified by conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGW RDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLG IYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQ GYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDD IQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSR AQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRI HKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYE AQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQHHHHHH
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      18 to 411
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab222442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Acetylgalactosaminidase, alpha N (alpha galactosidase B)
    • Alpha galactosidase B
    • Alpha N acetylgalactosaminidase
    • GALB
    • N acetylgalactosaminidase, alpha
    see all
  • Relevance

    NAGA encodes the lysosomal enzyme alpha N acetylgalactosaminidase, which cleaves alpha N acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). Alpha galactosidase B was first found to be an isoenzyme of alpha galactosidases, but apparently it differs from alpha galactosidase A in substrate specificity and is alpha N acetylgalactosaminidase.
  • Cellular localization

    Lysosome

Images

  • ab222442 (3 μg) was analysed by 15% SDS-PAGE.

    Predicted molecular mass: 45.5 kDa

References

ab222442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up