Description

  • Product name

    Recombinant Human NAIP protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTV KSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKW ILPFSPIIQK
    • Amino acids

      1294 to 1403
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Baculoviral IAP repeat containing 1
    • Baculoviral IAP repeat-containing protein 1
    • BIRC 1
    • BIRC1
    • BIRC1_HUMAN
    • Birc1a
    • FLJ42520
    • NAIP
    • Naip1
    • Neuronal apoptosis inhibitory protein
    • NLR family apoptosis inhibitory protein
    • NLR family BIR domain containing 1
    • NLRB 1
    • NLRB1
    • Nucleotide binding oligomerization domain leucine rich repeat and BIR domain containing 1
    • Psi neuronal apoptosis inhibitory protein
    • psiNAIP
    • Similar to occludin
    see all
  • Function

    Prevents motor-neuron apoptosis induced by a variety of signals. Possible role in the prevention of spinal muscular atrophy that seems to be caused by inappropriate persistence of motor-neuron apoptosis: mutated or deleted forms of NAIP have been found in individuals with severe spinal muscular atrophy.
  • Tissue specificity

    Expressed in motor neurons, but not in sensory neurons. Found in liver and placenta, and to a lesser extent in spinal cord.
  • Sequence similarities

    Contains 3 BIR repeats.
    Contains 1 NACHT domain.
  • Information by UniProt

Images

  • ab158950 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up