Description

  • Product name

    Recombinant Human NALP12/NLRP12 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEK AGPLEMAQLLITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPP GGPSSLGNQS
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as NALP12

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CLR19.3
    • FCAS2
    • Monarch 1
    • Monarch-1
    • NACHT, leucine rich repeat and PYD containing 12
    • NACHT, LRR and PYD containing protein 12
    • NACHT, LRR and PYD domains-containing protein 12
    • NAL12_HUMAN
    • NLR family, pyrin domain containing 12
    • NLRP12
    • Nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 12
    • OTTHUMP00000067227
    • PAN6
    • PYPAF7
    • PYRIN containing APAF1 like protein 7
    • PYRIN-containing APAF1-like protein 7
    • Regulated by nitric oxide
    • RNO
    • RNO2
    see all
  • Function

    May mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.
  • Tissue specificity

    Detected only in peripheral blood leukocytes, predominantly in eosinophils and granulocytes, and at lower levels in monocytes.
  • Involvement in disease

    Defects in NLRP12 are the cause of familial cold autoinflammatory syndrome type 2 (FCAS2) [MIM:611762]. FCAS are rare autosomal dominant systemic inflammatory diseases characterized by episodes of rash, arthralgia, fever and conjunctivitis after generalized exposure to cold.
  • Sequence similarities

    Belongs to the NLRP family.
    Contains 1 DAPIN domain.
    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab164872 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up