Overview

  • Product name

    Recombinant Human NALP2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKA DGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSF NKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFK GKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRV LPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCREL SRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGAL IEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE PIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAV CWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTL SLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYS FIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDL IQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVT DLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNL QKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKD LMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLA LRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQW ADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENC HLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQ TLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALR KPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVK MLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHP WAERPSSHDFMI
    • Molecular weight

      147 kDa including tags
    • Amino acids

      1 to 1062

Specifications

Our Abpromise guarantee covers the use of ab132431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CLR19.9
    • FLJ20510
    • Leucine rich repeat and PYD containing protein 2
    • LRR and PYD domains-containing protein 2
    • NACHT
    • NACHT domain
    • NACHT leucine rich repeat and PYD containing 2
    • NACHT LRR and PYD domains containing protein 2
    • NALP2
    • NALP2_HUMAN
    • NBS1
    • NLR family pyrin domain containing 2
    • NLRP2
    • Nucleotide binding oligomerization domain leucine rich repeat and pyrin domain containing 2
    • Nucleotide-binding site protein 1
    • PAN1
    • PYPAF2
    • PYRIN containing APAF1 like protein2
    • PYRIN domain and NACHT domain-containing protein 1
    • PYRIN-containing APAF1-like protein 2
    see all
  • Function

    Suppresses TNF- and CD40-induced NFKB1 activity at the level of the IKK complex, by inhibiting NFKBIA degradation induced by TNF. When associated with PYCARD, activates CASP1, leading to the secretion of mature proinflammatory cytokine IL1B. May be a component of the inflammasome, a protein complex which also includes PYCARD, CARD8 and CASP1 and whose function would be the activation of proinflammatory caspases.
  • Tissue specificity

    Expressed at high levels in lung, placenta and thymus and at lower levels in ovary, intestine and brain.
  • Sequence similarities

    Belongs to the NLRP family.
    Contains 1 DAPIN domain.
    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Domain

    The DAPIN domain is necessary and sufficient for suppression of NFKB1 activation induced by TNF and for inducing IL1B secretion in collaboration with caspase-1. It is involved in interaction with PYCARD.
    When isolated, the NACHT domain is involved in interaction with CARD8. This interaction is not detected for the full-length protein, maybe due to autoinhibition, this inhibition might by relieved by an inducible change in protein folding.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132431 stained with Coomassie Blue.

References

ab132431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up