Description

  • Product name

    Recombinant Human NANS protein
    See all NANS proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab101109 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQ GDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKT YGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFF KVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFC FLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVAL GAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNL VGKKVLVTVEEDDTIMEELVDNHGKKIKS
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 359
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • EC 2.5.1.56
    • EC 2.5.1.57
    • N acetylneuraminate 9 phosphate synthase
    • N acetylneuraminate synthase
    • N acetylneuraminic acid phosphate synthase
    • N acetylneuraminic acid synthase
    • N-acetylneuraminate synthase
    • N-acetylneuraminate-9-phosphate synthase
    • N-acetylneuraminic acid phosphate synthase
    • N-acetylneuraminic acid synthase
    • NANS
    • OTTHUMP00000021769
    • SAS
    • Sialic acid phosphate synthase
    • Sialic acid synthase
    • SIAS_HUMAN
    see all
  • Function

    Produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 AFP-like domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101109.

References

ab101109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up