Recombinant Human NAP1 (C12orf30) / p120 protein (ab164185)

Overview

  • Product name
    Recombinant Human NAP1 (C12orf30) / p120 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVL KAIGLQRTGKQEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELVTK LYEAAVKKVPNSEEYHSHLFMAYARVGEYKKMQQAGMALYKIVPKNPYYF WSVMSLIMQSISAQDENLSKTMFLPLAERMVEKMVKEDKIEAEAEVELYY MILERLGKYQEALDVIRGKLGEKLTSEIQSRENKCMAMYKKLSRWPECNA LSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWSPPAEGEHSLEGEVHYSAE KAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEE LMFQYFKKFGDKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTED KLALPADIRALQQHLCVVQLTRLLGLYHTMDKNQKLSVVRELMLRYQHGL EFGKTCLKTELQFSDYYCLLAVHALIDVWRETGDETTVWQALTLLEEGLT HSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHDTIGYLLTRYA ESLGQYAAASQSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFR NRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDDIPWE DLRDNRDLNVFFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGL PSLNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQ YPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQER IENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISV ILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTL ISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYL HSLLEMGELLKKRLETTKKLKI
    • Amino acids
      1 to 972
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C12orf30
    • DKFZp667K2112
    • FLJ1308
    • MDM20
    • Mitochondrial distribution and morphology 20
    • Mitochondrial distribution and morphology protein 20
    • N(alpha)-acetyltransferase 25, NatB auxiliary subunit
    • N-alpha-acetyltransferase 25, NatB auxiliary subunit
    • N-terminal acetyltransferase B complex subunit MDM20
    • N-terminal acetyltransferase B complex subunit NAA25
    • Naa25
    • NAA25_HUMAN
    • NAP1
    • NatB complex subunit MDM20
    • p120
    • TPR repeat-containing protein C12orf30
    see all
  • Function
    Non-catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.
  • Sequence similarities
    Belongs to the MDM20/NAA25 family.
    Contains 4 TPR repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164185 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up