Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LIRIPLHRVQPGRRTLNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRD VQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPK ASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPS LVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDP EEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCA KGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPA VSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGD VFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
    • Molecular weight

      69 kDa including tags
    • Amino acids

      26 to 420

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Asp 4
    • ASP4
    • Aspartyl protease 4
    • KAP
    • Kdap
    • Kidney derived aspartic protease like protein
    • NAP1
    • NAPA
    • Napsa
    • NAPSA_HUMAN
    • Napsin 1
    • napsin A aspartic peptidase
    • Napsin A precursor
    • Napsin-1
    • Napsin-A
    • Pronapsin A
    • SNAPA
    • TA01/TA02
    see all
  • Function

    May be involved in processing of pneumocyte surfactant precursors.
  • Tissue specificity

    Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the peptidase A1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131805 stained with Coomassie Blue.

References

ab131805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up